• Featured Product
  • KD/KO Validated

IFIH1/MDA5 Monoclonal antibody

IFIH1/MDA5 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 66770-1-Ig
Clone No.3D8B11

Host / Isotype

Mouse / IgG1

Reactivity

human and More (3)

Applications

WB, IHC, IF, FC (Intra), ELISA

IFIH1, MDA5, 3D8B11, CADM-140 autoantigen, Clinically amyopathic dermatomyositis autoantigen 140 kDa

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMDA-MB-468 cells, HepG2 cells, THP-1 cells, Jurkat cells, Daudi cells, Raji cells, T-47D cells
Positive IHC detected inhuman liver cancer tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66770-1-Ig targets IFIH1/MDA5 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, pig, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17448

Product name: Recombinant human IFIH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-310 aa of BC111750

Sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRP

Predict reactive species
Full Name interferon induced with helicase C domain 1
Calculated Molecular Weight 1025 aa, 117 kDa
Observed Molecular Weight 117-125 kDa
GenBank Accession NumberBC111750
Gene Symbol IFIH1
Gene ID (NCBI) 64135
RRIDAB_2882116
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BYX4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFIH1 (Interferon-induced helicase C domain-containing protein 1) is a putative RNA helicase that is upregulated in response to treatment with IFNB or IFNB and MEZ. It is also named as MDA5 and RH116. Ectopic expression of MDA5 in melanoma cells resulted in reduced colony formation, suggesting an interaction of the CARD and apoptotic signal molecules. Functional analysis indicated that MDA5 is an RNA-dependent ATPase. IFIH1 has an apparent molecular mass of 117-130 kDa, and always other bands (70 kDa and 90 kDa) can be detected as cleaved products (PMID: 17267501).

Protocols

Product Specific Protocols
FC protocol for IFIH1/MDA5 antibody 66770-1-IgDownload protocol
IHC protocol for IFIH1/MDA5 antibody 66770-1-IgDownload protocol
WB protocol for IFIH1/MDA5 antibody 66770-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Adv Sci (Weinh)

ADAR1 as a Placental Innate Immune Rheostat Sustaining the Homeostatic Balance of Intrinsic Interferon Response at the Maternal-Fetal Interface

Authors - Xiaogang Chen
WB

Virol Sin

PRRSV degrades MDA5 via dual autophagy receptors P62 and CCT2 to evade antiviral innate immunity

Authors - Ruiqi Sun
  • KO Validated
humanWB

J Virol

Encephalomyocarditis virus abrogates the IFN-β signaling pathway via its structural protein VP2.

Authors - Yumei Han
humanWB

Vet Microbiol

DDX56 antagonizes IFN-β production to enhance EMCV replication by inhibiting IRF3 nuclear translocation

Authors - Shujuan Xu
humanWB

Virus Res

Host protein, HSP90β, antagonizes IFN-β signaling pathway and facilitates the proliferation of encephalomyocarditis virus in vitro.

Authors - Qian Li
pigWB

Front Immunol

Temporally integrated transcriptome analysis reveals ASFV pathology and host response dynamics

Authors - Lin Lv

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

RASHMI (Verified Customer) (07-26-2024)

Used this product, highly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK-293
Loading...
||
New chat

Able

正在加载,请稍候...