IFN-alpha Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IFN-alpha Recombinant monoclonal antibody (87610-3-RR)

IFN-alpha Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87610-3-RR

Clone No.252039C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

IFN ALPHA, IFNA1, IFN alpha 1/13, IFN alpha1, IFNA 1

• 

  WB analysis of Recombinant protein using 87610-3-RR

  Human IFN-alpha recombinant protein was subjected to SDS PAGE followed by western blot with 87610-3-RR (IFNA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87610-3-RR

  CHO cells transfected with human IFN-alpha were subjected to SDS PAGE followed by western blot with 87610-3-RR (IFNA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Transfected CHO using 87610-3-RR

  Immunofluorescent analysis of (4% PFA) fixed Transfected CHO using IFN-alpha antibody (87610-3-RR, Clone: 252039C10 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87610-3-RR

  Biolayer interferometry (BLI) kinetic assays of 87610-3-RR against Human IFN-alpha were performed. The affinity constant is 0.989 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Recombinant protein, Transfected with IFNA1 CHO cells
• Positive IF/ICC detected in: Transfected CHO

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87610-3-RR targets IFN-alpha in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2592

  Product name: Recombinant Human IFNA1 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-189 aa of NM_024013.2

  Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

• Full Name: IFNA1
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_024013.2
• Gene Symbol: IFN alpha1
• Gene ID (NCBI): 3439
• RRID: AB_3745647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01562
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFNA1 (IF-alpha) is a member of the Type I IFN (1) family best known for their antiviral activity. It is a key cytokine regulating the activity of B cells, T-helper cells (Th cells), cDCs and natural killer cells (NK cells). IFNA1 induces B cell maturation into plasma cells and immunoglobulin production. IFNA1 plays an important role in the pathogenesis of systemic lupus erythematosus (SLE). IFNA1 was the first cytokine to show clinical benefit in the treatment of certain types of cancer, including melanoma, chronic myelogenous leukemia, and renal cancer.