IFN-alpha Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IFN-alpha Recombinant monoclonal antibody, PBS Only (87610-3-PBS)

IFN-alpha Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87610-3-PBS

Clone No.252039C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

IFN ALPHA, IFNA1, IFN alpha 1/13, IFN alpha1, IFNA 1

• 

  WB analysis of Recombinant protein using 87610-3-RR (same clone as 87610-3-PBS)

  Human IFN-alpha recombinant protein was subjected to SDS PAGE followed by western blot with 87610-3-RR (IFNA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87610-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87610-3-RR (same clone as 87610-3-PBS)

  CHO cells transfected with human IFN-alpha were subjected to SDS PAGE followed by western blot with 87610-3-RR (IFNA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87610-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Transfected CHO using 87610-3-RR (same clone as 87610-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Transfected CHO using IFN-alpha antibody (87610-3-RR, Clone: 252039C10 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004). This data was developed using the same antibody clone with 87610-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87610-3-RR

  Biolayer interferometry (BLI) kinetic assays of 87610-3-RR against Human IFN-alpha were performed. The affinity constant is 0.989 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87610-3-PBS targets IFN-alpha in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2592

  Product name: Recombinant Human IFNA1 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-189 aa of NM_024013.2

  Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

• Full Name: IFNA1
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_024013.2
• Gene Symbol: IFN alpha1
• Gene ID (NCBI): 3439
• RRID: AB_3745647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01562
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IFNA1 (IF-alpha) is a member of the Type I IFN (1) family best known for their antiviral activity. It is a key cytokine regulating the activity of B cells, T-helper cells (Th cells), cDCs and natural killer cells (NK cells). IFNA1 induces B cell maturation into plasma cells and immunoglobulin production. IFNA1 plays an important role in the pathogenesis of systemic lupus erythematosus (SLE). IFNA1 was the first cytokine to show clinical benefit in the treatment of certain types of cancer, including melanoma, chronic myelogenous leukemia, and renal cancer.