Tested Applications
| Positive FC (Intra) detected in | ConA, PMA and ionomycin stimulated rat splenocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
PE-98001 targets IFN-gamma in FC (Intra) applications and shows reactivity with rat samples.
| Tested Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0400 Product name: Recombinant Rat IFN-gamma protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-156 aa of NM_138880 Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC Predict reactive species |
| Full Name | interferon gamma |
| Calculated Molecular Weight | 18 kDa |
| GenBank Accession Number | NM_138880 |
| Gene Symbol | IFN-gamma |
| Gene ID (NCBI) | 25712 |
| RRID | AB_3674014 |
| Conjugate | PE Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 496 nm, 565 nm / 578 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01581 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PE IFN-gamma antibody PE-98001 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

