Anti-Rat IFN-gamma Rabbit Recombinant Antibody

IFN-gamma Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98001-1-RR
Clone No.6K20

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

IFN Gamma, Ifng, interferon gamma, 6K20, IFN γ

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inConA, PMA and ionomycin stimulated Wistar rat splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98001-1-RR targets IFN-gamma in FC (Intra) applications and shows reactivity with rat samples.

Tested Reactivity rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0400

Product name: Recombinant Rat IFN-gamma protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 23-156 aa of NM_138880

Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Predict reactive species
Full Name interferon gamma
Calculated Molecular Weight18 kDa
GenBank Accession NumberNM_138880
Gene Symbol IFN-gamma
Gene ID (NCBI) 25712
RRIDAB_3672145
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01581
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Stable for one year after shipment.

Background Information

Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427)

Protocols

Product Specific Protocols
FC protocol for IFN-gamma antibody 98001-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...