CoraLite® Plus 647 Anti-Rat IFN-gamma Rabbit Recombinant Antibody

• 

  FC experiment of rat splenocytes using CL647-98001

  1x10^6 unstimulated or ConA, PMA and ionomycin stimulated (in the presence of protein transport inhibitors) rat splenocytes cells were intracellularly stained with 0.25 ug CoraLite® Plus 647 Anti-Rat IFN-gamma (6K20) Rabbit Recombinant Antibody (CL647-98001, Clone:6K20), and 0.25 ug CoraLite® Plus 647-conjugated Rabbit IgG control Rabbit PolyAb (CL647-30000), and 0.25 ug FITC Plus Anti-Rat CD4 (OX-35) (FITC-65179, Clone: OX-35). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

IFN-gamma Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. CL647-98001

Clone No.6K20

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

IFN Gamma, Ifng, interferon gamma, 6K20, IFN γ

---

Tested Applications

• Positive FC (Intra) detected in: ConA, PMA and ionomycin stimulated rat splenocytes

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98001 targets IFN-gamma in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0400

  Product name: Recombinant Rat IFN-gamma protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-156 aa of NM_138880

  Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

• Full Name: interferon gamma
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: NM_138880
• Gene Symbol: IFN-gamma
• Gene ID (NCBI): 25712
• RRID: AB_3673652
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01581
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427)