FcZero-rAb® PE Anti-Mouse IFN-gamma Rabbit Recombinant Antibody

• 

  FC experiment of C57BL/6 Th1-polarized splenocytes using PE-FcA98045

  1x10^6 unteated or PMA, Ionomycin and Brefeldin A treated C57BL/6 Th1-polarized splenocytes were intracellularly stained with FcZero-rAb™ APC Anti-Mouse CD4 and 0.1 ug PE Anti-Mouse IFN-gamma Rabbit RecAb (PE-FcA98045, Clone:240262C9). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  FC experiment of C57BL/6 Th1-polarized splenocytes using PE-FcA98045

  1x10^6 PMA, Ionomycin and Brefeldin A treated C57BL/6 Th1-polarized splenocytes were intracellularly stained with 0.1 ug PE Anti-Mouse IFN-gamma Rabbit RecAb (PE-FcA98045, Clone: 240262C9) (red) or 0.1 ug PE Rabbit IgG Isotype Control RecAb (PE-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated C57BL/6 Th1-polarized splenocytes were intracellularly stained with0.25 ug CoraLite® Plus 647 Anti-Mouse IFN-gamma Rabbit RecAb (CL647-FcA98045, Clone: 240262C9) (black, dashed). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

IFN-gamma FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. PE-FcA98045

Clone No.240262C9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

IFN gamma, Ifng, Ifg, IFN g, IFN γ

---

Tested Applications

• Positive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated C57BL/6 Th1-polarized splenocytes

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98045 targets IFN-gamma in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0334

  Product name: Recombinant Mouse IFN-gamma/IFNG protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-155 aa of BC119063

  Sequence: HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

• Full Name: interferon gamma
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: BC119063
• Gene Symbol: IFN gamma
• Gene ID (NCBI): 15978
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01580
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427)