CoraLite® Plus 647-conjugated IFN-gamma R2 Polyclonal antibody

• 

  IF Staining of A549 using CL647-10266

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite® Plus 647 IFN-gamma R2 antibody (CL647-10266) at dilution of 1:600.

IFN-gamma R2 Polyclonal Antibody for IF/ICC

Cat No. CL647-10266

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

IFNGR2, AF 1, AF-1, IFGR2, IFN gamma R2

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10266 targets IFN-gamma R2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0317

  Product name: Recombinant human IFNGR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-324 aa of BC003624

  Sequence: WVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIIS

• Full Name: interferon gamma receptor 2 (interferon gamma transducer 1)
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC003624
• Gene Symbol: IFNGR2
• Gene ID (NCBI): 3460
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38484
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Interferon-gamam (IFN-γ) is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Cellular responses to IFN-γ are activated through its interaction with a heterodimeric receptor consisting of two subunits, IFNGR1 and IFNGR2. IFNGR1 is the ligand-binding subunit which binds IFN-γ with high affinity, whereas IFNGR2 serves as the accessory subunit which attaches to IFN-γ with a significantly lower affinity. Two subunits bind one IFN-γ dimer. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. (PMID: 17981204; 946248; 10888113)