CoraLite®594 Anti-Human IFNGR1/CD119 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite®594 Anti-Human IFNGR1/CD119 Rabbit Recombinant Antibody (CL594-98343)

IFNGR1/CD119 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL594-98343

Clone No.242632A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

IFNGR1, 242632A8, CD119, IFN gamma R1, IFN gamma receptor 1

• 

  FC experiment of human PBMCs using CL594-98343

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite®594 Anti-Human IFNGR1/CD119 Rabbit RecAb (CL594-98343, Clone: 242632A8) or CoraLite®594 Rabbit IgG Isotype Control Recombinant Antibody (CL594-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL594-98343

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite®594 Anti-Human IFNGR1/CD119 Rabbit RecAb (CL594-98343, Clone: 242632A8) (red) or CoraLite®594 Rabbit IgG Isotype Control Recombinant Antibody (CL594-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98343 targets IFNGR1/CD119 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2999

  Product name: Recombinant Human IFNGR1 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 18-245 aa of NM_000416.3

  Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

• Full Name: interferon gamma receptor 1
• Calculated Molecular Weight: 54 kDa
• GenBank Accession Number: NM_000416.3
• Gene Symbol: IFNGR1
• Gene ID (NCBI): 3459
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15260-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interferon-gamam (IFN-γ) is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Cellular responses to IFN-γ are activated through its interaction with a heterodimeric receptor consisting of two subunits, IFNGR1 (CD119) and IFNGR2. IFNGR1 is the ligand-binding subunit which binds IFN-γ with high affinity, whereas IFNGR2 serves as the accessory subunit. Two subunits bind one IFN-γ dimer. Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. (PMID: 17981204; 946248; 10888113)