IFT172 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IFT172 Polyclonal antibody, PBS Only (28441-1-PBS)

• 

  WB analysis using 28441-1-AP (same clone as 28441-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28441-1-AP (IFT172 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28441-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28441-1-AP (same clone as 28441-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28441-1-AP (IFT172 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28441-1-AP (same clone as 28441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28441-1-AP (IFT172 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28441-1-AP (same clone as 28441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28441-1-AP (IFT172 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28441-1-PBS in a different storage buffer formulation.

• 

  IF Staining of ARPE-19 using 28441-1-AP (same clone as 28441-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed ARPE-19 cells using IFT172 antibody (28441-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28441-1-PBS in a different storage buffer formulation.

IFT172 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28441-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

28441-1-PBS targets IFT172 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28921

  Product name: Recombinant human IFT172 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1206-1408 aa of BC137126

  Sequence: QARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREATKKGARGVEGFVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDS

• Full Name: intraflagellar transport 172 homolog (Chlamydomonas)
• Calculated Molecular Weight: 1749 aa, 198 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC137126
• Gene Symbol: IFT172
• Gene ID (NCBI): 26160
• RRID: AB_2881142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UG01
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.