Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human IGF1 Rabbit Recombinant Antibody, PBS Only (98889-3-PBS)

Anti-Human IGF1 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Human IGF1 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98889-3-PBS-1MG

IGF1 Uni-rAb^® Recombinant Antibody for IHC, FC (Intra)

Cat No. 98889-3-PBS

Clone No.252943B2

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC (Intra)

Synonyms

IGF-1, IGF I, IGFI, IGF-I, Insulin like growth factor I

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCFC (Intra)

IHC staining of human liver using 98889-3-RR (same clone as 98889-3-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 98889-3-RR (IGF1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.
IHC staining of human liver using 98889-3-RR (same clone as 98889-3-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 98889-3-RR (IGF1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.
FC experiment of A549 using 98889-3-RR (same clone as 98889-3-PBS)
1x10^6 A549 cells were intracellularly stained with 0.25 ug Anti-Human IGF1 Rabbit RecAb (98889-3-RR, Clone: 252943B2) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.
×
1x10^6 A549 cells were intracellularly stained with 0.25 ug Anti-Human IGF1 Rabbit RecAb (98889-3-RR, Clone: 252943B2) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.
FC experiment of Transfected HEK-293T using 98889-3-RR (same clone as 98889-3-PBS)
1x10^6 HEK-293T cells and IGF1 Transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Human IGF1 Rabbit RecAb (98889-3-RR, Clone: 252943B2) and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.
×
1x10^6 HEK-293T cells and IGF1 Transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Human IGF1 Rabbit RecAb (98889-3-RR, Clone: 252943B2) and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.
FC experiment of Transfected HEK-293T using 98889-3-RR (same clone as 98889-3-PBS)
1x10^6 HEK-293T cells and IGF1 Transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Human IGF1 Rabbit RecAb (98889-3-RR, Clone: 252943B2) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.
×
1x10^6 HEK-293T cells and IGF1 Transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Human IGF1 Rabbit RecAb (98889-3-RR, Clone: 252943B2) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and CoraLite647-conjugated F(ab')2 Fragment Donkey Anti-Rabbit IgG (H+L) (SA00014-7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98889-3-PBS in a different storage buffer formulation.

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98889-3-PBS targets IGF1 in IHC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1806 Product name: recombinant human IGF1 protein Source: mammalian cells-derived, pHZ-KIsec-N-mFc Tag: N-mFc Domain: 49-118 aa of NM_001111285.2 Sequence: EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Predict reactive species
Full Name	insulin-like growth factor 1 (somatomedin C)
Calculated Molecular Weight	22 kDa
GenBank Accession Number	NM_001111285.2
Gene Symbol	IGF1
Gene ID (NCBI)	3479
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P05019-1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The Insulin like growth factor-1, also known as Somatomedin-C is a growth factor which is structurally related to insulin and is an important regulator of growth and differentiation in various tissues and cell systems. Human IGF-1 is synthesized as two precursor isoforms with N- and alternate C-terminal propeptide. The two precursor isoforms are differentially expressed by various tissues. The proteolytic cleavage of the N- and C-terminal regions results in the mature IGF-1 protein which is identical between isoforms. IGF-1 binds to IGF-1 receptor and induces receptor autophosphorylation. This further phosphorylates Insulin receptor substrate -1 (IRS-1) and activates various downstream signaling pathways including the PI3-AKT, MAPK etc. (PMID: 17354613, 17113337, 29535161)