Use Able AI chat for product recommendations

Anti-Human IGF1 Rabbit Recombinant Antibody

IGF1 Uni-rAb® Recombinant Antibody for IHC, FC (Intra)

Cat No. 98889-3-RR
Clone No.252943B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC (Intra)

IGF-1, IGF I, IGFI, IGF-I, Insulin like growth factor I

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inA549 cells, Transfected HEK-293T cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98889-3-RR targets IGF1 in IHC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1806

Product name: recombinant human IGF1 protein

Source: mammalian cells-derived, pHZ-KIsec-N-mFc

Tag: N-mFc

Domain: 49-118 aa of NM_001111285.2

Sequence: EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

Predict reactive species
Full Name insulin-like growth factor 1 (somatomedin C)
Calculated Molecular Weight 22 kDa
GenBank Accession NumberNM_001111285.2
Gene Symbol IGF1
Gene ID (NCBI) 3479
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05019-1
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

The Insulin like growth factor-1, also known as Somatomedin-C is a growth factor which is structurally related to insulin and is an important regulator of growth and differentiation in various tissues and cell systems. Human IGF-1 is synthesized as two precursor isoforms with N- and alternate C-terminal propeptide. The two precursor isoforms are differentially expressed by various tissues. The proteolytic cleavage of the N- and C-terminal regions results in the mature IGF-1 protein which is identical between isoforms. IGF-1 binds to IGF-1 receptor and induces receptor autophosphorylation. This further phosphorylates Insulin receptor substrate -1 (IRS-1) and activates various downstream signaling pathways including the PI3-AKT, MAPK etc. (PMID: 17354613, 17113337, 29535161)

Protocols

Product Specific Protocols
FC protocol for IGF1 antibody 98889-3-RRDownload protocol
IHC protocol for IGF1 antibody 98889-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...