• Featured Product
  • KD/KO Validated

CoraLite® Plus 750-conjugated IGF2BP3 Recombinant monoclonal antibody

IGF2BP3 Uni-rAb® Recombinant Antibody for WB, FC (Intra)
Cat No. CL750-81805
Clone No.1L11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra)

1L11, IGF2 mRNA-binding protein 3, IGF2BP 3, IGF-II mRNA-binding protein 3, IMP 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, HepG2 cells, K-562 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-81805 targets IGF2BP3 in WB, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6226

Product name: Recombinant human IGF2BP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 240-579 aa of BC065269

Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

Predict reactive species
Full Name insulin-like growth factor 2 mRNA binding protein 3
Calculated Molecular Weight 64 kDa
Observed Molecular Weight64 kDa
GenBank Accession NumberBC065269
Gene Symbol IGF2BP3
Gene ID (NCBI) 10643
RRIDAB_3673736
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00425
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IGF2BP3, also named IMP3, KOC1, and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma. Both isoforms (64kd and 22kd) of IGFBP3 can be recognized by this antibody. And IGFBP3 is nuclear and cytoplasm stains.

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 IGF2BP3 antibody CL750-81805Download protocol
WB protocol for CL Plus 750 IGF2BP3 antibody CL750-81805Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...