IGFL4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IGFL4 Polyclonal antibody, PBS Only (33339-1-PBS)

• 

  IHC staining of mouse cerebellum using 33339-1-AP (same clone as 33339-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 33339-1-AP (IGFL4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33339-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 33339-1-AP (same clone as 33339-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 33339-1-AP (IGFL4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33339-1-PBS in a different storage buffer formulation.

IGFL4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 33339-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Insulin growth factor-like family member 4

---

Product Information

33339-1-PBS targets IGFL4 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37543

  Product name: Recombinant human IGFL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-124 aa of NM_001002923

  Sequence: EGVTDLRLWLCQPAPRCGEWTYNPLEQCCDDGVILDLNQTRLCGSSCTFWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI

• Full Name: IGF-like family member 4
• Calculated Molecular Weight: 14 kDa
• GenBank Accession Number: NM_001002923
• Gene Symbol: IGFL4
• Gene ID (NCBI): 444882
• RRID: AB_3742946
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6B9Z1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IGFL (Insulin-like growth factor like family) encode a family of small secreted proteins in Homo sapiens and Mus musculus. This family consists of four genes and two pseudogenes (IGFL1-4 and IGFL1P1-2). IGFL1 is expressed in the ovary and spinal cord. IGFL2 is expressed in the cerebellum, heart, placenta, spleen, stomach, testis and thymus. IGFL3 and IGFL4 are expressed in the cerebellum. The IGFL4 protein binds to the insulin-like growth factor receptor (IGF-1R) and the insulin receptor (IR), thereby activating downstream signaling pathways such as the PI3K/AKT and MAPK pathway.(PMID: 16890402).