• KD/KO Validated

CoraLite® Plus 488-conjugated IKZF1 Monoclonal antibody

IKZF1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66966
Clone No.1D6B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

IF/ICC, FC (Intra)

IKAROS, IK1, Hs.54452, hIk 1, DNA-binding protein Ikaros

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells
Positive FC (Intra) detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66966 targets IKZF1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, pig, rabbit samples.

Tested Reactivity human, mouse, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28637

Product name: Recombinant human IKZF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-303 aa of BC018349

Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS

Predict reactive species
Full Name IKAROS family zinc finger 1 (Ikaros)
Calculated Molecular Weight 477 aa, 53 kDa
Observed Molecular Weight 55-65 kDa
GenBank Accession NumberBC018349
Gene Symbol IKZF1
Gene ID (NCBI) 10320
RRIDAB_2934506
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13422
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with MV 58KDa, 48KDa, 48KDa, 43KDa, 41KDa, 32KDa and 53KDa, respectively.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 IKZF1 antibody CL488-66966Download protocol
IF protocol for CL Plus 488 IKZF1 antibody CL488-66966Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...