CoraLite® Plus 488-conjugated IKZF4 Recombinant monoclonal antibody

IKZF4 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83471-5
Clone No.240357D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

ZNFN1A4, Zinc finger protein Eos, KIAA1782, IKZF 4, EOS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83471-5 targets IKZF4 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34767

Product name: Recombinant human IKZF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 268-457 aa of BC160169

Sequence: ERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDST

Predict reactive species
Full Name IKAROS family zinc finger 4 (Eos)
Observed Molecular Weight60 kDa
GenBank Accession NumberBC160169
Gene Symbol IKZF4
Gene ID (NCBI) 64375
RRIDAB_3673255
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H2S9
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IKZF4 is a member of the Ikaros family transcription factors. The Ikaros family was originally designated to function in hematopoiesis, but it is only recently that studies have begun to show the relevance of this family in T helper cell differentiation. IKZF3 was preferentially expressed in TH17 cells and governs TH17 differentiation by silencing IL-2 expression. By investigating the dynamics of the TH17 regulatory network, IKZF4 was proposed by Yosef et al. as a composite in the negative regulatory module for TH17. (PMID: 24644282)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 IKZF4 antibody CL488-83471-5Download protocol
IF protocol for CL Plus 488 IKZF4 antibody CL488-83471-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...