IL-1 beta Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-1 beta Recombinant monoclonal antibody (84136-5-RR)

IL-1 beta Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84136-5-RR Copied!

Clone No. 241364D5

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

IL 1beta, Il1b, 241364D5, IL 1 beta, Il 1b

• 

  WB analysis of THP-1 using 84136-5-RR

  LPS and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 84136-5-RR

  LPS and Brefeldin A treated RAW264.7 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:4000, incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 84136-5-RR

  PMA, LPS and Brefeldin A treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of RAW 264.7 using 84136-5-RR

  Immunofluorescent analysis of (4% PFA) fixed LPS and Brefeldin A treated RAW 264.7 cells using IL-1 beta antibody (84136-5-RR, Clone: 241364D5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84136-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84136-5-RR against Mouse IL-1 beta were performed. The affinity constant is 13.2 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-1 beta in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LPS and Brefeldin A treated THP-1 cells, LPS and Brefeldin A treated RAW 264.7 cells, PMA, LPS and Brefeldin A treated RAW 264.7 cells
• Positive IF/ICC detected in: LPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84136-5-RR targets IL-1 beta in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1577

  Product name: Recombinant Mouse IL-1 beta protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 118-269 aa of NM_008361.4

  Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

• Full Name: interleukin 1 beta
• Calculated Molecular Weight: 31kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_008361.4
• Gene Symbol: IL-1 beta
• Gene ID (NCBI): 16176
• RRID: AB_3671695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.

Publications

What published studies show

The IL-1 beta Recombinant monoclonal antibody (241364D5), catalog number 84136-5-RR, has 2 citations. One appears in Journal of Ethnopharmacology, studying atherosclerosis and vascular inflammation via the NF-κB/NLRP3 pathway in ApoE-deficient mice. The other is in Cell Signaling, investigating uric acid-induced renal fibrosis through the SMAD5/Id2 signaling pathway. Both studies used the antibody for Western blot in mouse samples, covering cardiovascular inflammation and renal fibrosis research fields.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Ethnopharmacol; Shenling Jiangzhi formula alleviates atherosclerosis in ApoE(-/-) mice by inhibiting vascular inflammation via the NF-κB/NLRP3 pathway.; Authors - Qinghe Kong
mouse	WB	Cell Signal; MicroRNA-93-5p alleviates uric acid-induced fibrosis in renal tubular epithelial cells by regulating the SMAD5/Id2 signaling pathway.; Authors - Xun Lu