IL-1 beta Recombinant monoclonal antibody

• 

  WB analysis of THP-1 using 84136-5-RR

  LPS and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84136-5-RR

  LPS and Brefeldin A treated RAW264.7 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:4000, incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 84136-5-RR

  PMA, LPS and Brefeldin A treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 84136-5-RR (IL-1 beta antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 84136-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84136-5-RR against Mouse IL-1 beta were performed. The affinity constant is 13.2 pM.

IL-1 beta Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84136-5-RR

Clone No.241364D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

IL 1beta, Il1b, 241364D5, IL 1 beta, Il 1b

---

Tested Applications

• Positive WB detected in: LPS and Brefeldin A treated THP-1 cells, LPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84136-5-RR targets IL-1 beta in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1577

  Product name: Recombinant Mouse IL-1 beta protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 118-269 aa of NM_008361.4

  Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

• Full Name: interleukin 1 beta
• Calculated Molecular Weight: 31kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_008361.4
• Gene Symbol: IL-1 beta
• Gene ID (NCBI): 16176
• RRID: AB_3671695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.