Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated IL-10 Recombinant monoclonal antibody

IL-10 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-82191-3
Clone No.240430G12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC

Il10, IL-10,IL10, 240430G12, CSIF, Il 10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inLPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82191-3 targets IL-10 in IF/ICC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0026

Product name: Recombinant Mouse IL-10 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: N-6*his

Domain: 19-178 aa of NM_010548

Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Predict reactive species
Full Name interleukin 10
Calculated Molecular Weight 21 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberNM_010548
Gene Symbol Il10
Gene ID (NCBI) 16153
RRIDAB_3673063
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18893
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IL-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IL-10 antibody CL488-82191-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...