Tested Applications
| Positive FC (Intra) detected in | PMA, Ionomycin and Brefeldin A treated C57BL/6 Th2-polarized splenocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-98003 targets IL-13 in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0266 Product name: Recombinant Mouse IL-13 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-131 aa of NM_008355 Sequence: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Predict reactive species |
| Full Name | interleukin 13 |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | NM_008355 |
| Gene Symbol | IL-13 |
| Gene ID (NCBI) | 16163 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P20109 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. IL-13 up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. IL-13 inhibits the production of a series of cytokines like IL-1, IL-6, TNF-alpha, and IL-8 by activated human monocytes. IL-13 induces IFN-gamma production by NK cells. IL-13 is thought to be an important cytokine in the pathogenesis of asthma, and more recently has been shown to play a pivotal role in a number of fibrotic diseases, including hepatic and pulmonary fibrosis, and nodular sclerosing Hodgkin's disease.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 647 IL-13 antibody CL647-98003 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
