Anti-Mouse IL-16 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse IL-16 Rabbit Recombinant Antibody (98535-1-RR)

IL-16 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98535-1-RR Copied!

Clone No. 250058E6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Il16, Interleukin-16, Pro-interleukin-16

• 

  FC experiment of Transfected HEK-293T using 98535-1-RR

  1x10^6 HEK-293T cells or IL-16 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse IL-16 Rabbit RecAb (98535-1-RR, Clone: 250058E6) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98535-1-RR

  1x10^6 HEK-293T cells or IL-16 transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse IL-16 Rabbit RecAb (98535-1-RR, Clone: 250058E6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-16 in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98535-1-RR targets IL-16 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3127

  Product name: Recombinant Mouse IL-16 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1205-1322 aa of NM_010551.3

  Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

• Full Name: interleukin 16
• Calculated Molecular Weight: 141 kDa
• GenBank Accession Number: NM_010551.3
• Gene Symbol: Il16
• Gene ID (NCBI): 16170
• RRID: AB_3746162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O54824-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. It is mainly produced by T lymphocytes but also by other immune cells, neuronal cells, fibroblasts and epithelial cells. The signaling process of this cytokine is mediated by CD4. IL-16 induces chemotaxis of CD4+ cells such as lymphocytes, eosinophils, and dendritic cells by ligating CD4 directly at a site distinct from other ligands. Among its multiple functions, IL-16 is a T cell chemoattractant involved in T helper cell inflammatory responses and the regulation of both T cell growth, and responsiveness to regulatory cytokines. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control.