Use Able AI chat for product recommendations

IL-17A Recombinant monoclonal antibody

IL-17A Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 87785-2-RR
Clone No.252603B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

IL 17, IL17, IL-17, IL17A, CTLA-8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPMA, Ionomycin and Brefeldin A treated EL-4 cells, Recombinant protein

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87785-2-RR targets IL-17A in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg5854

Product name: Recombinant human IL17A protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 24-155 aa of NM_002190.2

Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Predict reactive species
Full Name interleukin 17A
Calculated Molecular Weight18 kDa
Observed Molecular Weight14-18 kDa
GenBank Accession NumberNM_002190.2
Gene Symbol IL-17A
Gene ID (NCBI) 3605
ENSEMBL Gene IDENSG00000112115
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16552
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.

Protocols

Product Specific Protocols
WB protocol for IL-17A antibody 87785-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...