IL-17A Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-17A Recombinant monoclonal antibody (87785-2-RR)

• 

  WB analysis of EL-4 using 87785-2-RR

  PMA, Ionomycin and Brefeldin A treated EL-4 cells were subjected to SDS PAGE followed by western blot with 87785-2-RR (IL17A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Recombinant protein using 87785-2-RR

  Human IL-17A recombinant protein were subjected to SDS PAGE followed by western blot with 87785-2-RR (IL17A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IL-17A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87785-2-RR

Clone No.252603B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

IL 17, IL17, IL-17, IL17A, CTLA-8

---

Tested Applications

• Positive WB detected in: PMA, Ionomycin and Brefeldin A treated EL-4 cells, Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87785-2-RR targets IL-17A in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5854

  Product name: Recombinant human IL17A protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-155 aa of NM_002190.2

  Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

• Full Name: interleukin 17A
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 14-18 kDa
• GenBank Accession Number: NM_002190.2
• Gene Symbol: IL-17A
• Gene ID (NCBI): 3605
• ENSEMBL Gene ID: ENSG00000112115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16552
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.