IL-17A Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-17A Recombinant monoclonal antibody, PBS Only (Capture) (87785-2-PBS)

• 

  WB analysis of EL-4 using 87785-2-RR (same clone as 87785-2-PBS)

  PMA, Ionomycin and Brefeldin A treated EL-4 cells were subjected to SDS PAGE followed by western blot with 87785-2-RR (IL17A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87785-2-PBS in a different storage buffer formulation.

• 

  WB analysis of Recombinant protein using 87785-2-RR (same clone as 87785-2-PBS)

  Human IL-17A recombinant protein were subjected to SDS PAGE followed by western blot with 87785-2-RR (IL17A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87785-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP03186-1

  Serum of six individual healthy human donors was measured. The IL-17A concentration of detected samples was determined to be 0.2 ng/mL with a range of 0.1-0.6 ng/mL.

• 

  Sandwich ELISA sample test of MP03186-1

  Human peripheral blood mononuclear cells (PBMC) were cultured unstimulated or stimulated with 10 μg/mL PHA for 3 days. The mean IL-17A concentration was undectable in unstimulated PBMC supernatant, 458.6 pg/mL in PHA stimulated PBMC supernatant.

• 

  Sandwich ELISA standard curve of MP03186-1

  Sandwich ELISA standard curve of MP03186-1, Human IL-17A Recombinant Matched Antibody Pair - PBS only. 87785-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg5854. 87785-1-PBS was HRP conjugated as the detection antibody. Range: 31.3-2000 pg/mL.

IL-17A Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 87785-2-PBS

Clone No.252603B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

87785-2-PBS targets IL-17A as part of a matched antibody pair:

MP03186-1: 87785-2-PBS capture and 87785-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5854

  Product name: Recombinant human IL17A protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-155 aa of NM_002190.2

  Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

• Full Name: interleukin 17A
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 14-18 kDa
• GenBank Accession Number: NM_002190.2
• Gene Symbol: IL-17A
• Gene ID (NCBI): 3605
• ENSEMBL Gene ID: ENSG00000112115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16552
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.