Use Able AI chat for product recommendations

PE Anti-Mouse IL-18 Rabbit Recombinant Antibody

IL-18 Uni-rAb® Recombinant Antibody for FC (Intra)

Cat No. PE-98846-3
Clone No.252154A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

IFN-gamma-inducing factor, Igif, IL-1 gamma, Il18, Interferon gamma-inducing factor

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  PE
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inTransfected HEK-293T cells, Hepa 1-6 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-98846-3 targets IL-18 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4455

Product name: Recombinant Mouse IL-18 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 1-192 aa of NM_008360.1

Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Predict reactive species
Full Name interleukin 18
Calculated Molecular Weight22 kDa
GenBank Accession NumberNM_008360.1
Gene Symbol Il18
Gene ID (NCBI) 16173
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP70380
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

IL-18 is a proinflammatory cytokine involved in the development of Th1 cells and in immune response. It can stimulate the NK cells and certain T cells to release IFN gamma which plays an important role in activating the macrophages or other cells. IL-18 has been demonstrated to have the potential to enhance Fas ligand-mediated cytotoxicity, which is increased in PE and regulates placental apoptosis. IL-18 is synthesized as a 22 kDa precursor and then cleaved into a biologically activate 18 kDa form.

Protocols

Product Specific Protocols
FC protocol for PE IL-18 antibody PE-98846-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...