IL-18BP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IL-18BP Polyclonal antibody, PBS Only (14153-1-PBS)

• 

  WB analysis using 14153-1-AP (same clone as 14153-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14153-1-AP (IL-18BP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14153-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 14153-1-AP (same clone as 14153-1-PBS)

  WB result of IL-18BP antibody (14153-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IL-18BP transfected A549 cells. This data was developed using the same antibody clone with 14153-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IL-18BP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14153-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

IL18BP, IL 18BP, IL18BPa, interleukin 18 binding protein, Interleukin-18-binding protein

---

Product Information

14153-1-PBS targets IL-18BP in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5335

  Product name: Recombinant human IL-18BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-194 aa of BC044215

  Sequence: ATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

• Full Name: interleukin 18 binding protein
• Calculated Molecular Weight: 194 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC044215
• Gene Symbol: IL-18BP
• Gene ID (NCBI): 10068
• RRID: AB_2918034
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95998
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL18BP, also named as adekinig-alfa, has 3 isoforms (Isoform A 21kd; B 12kd and D 17kd). Isoform A binds to IL-18 and inhibits its activity. IL18BP functions as an inhibitor of the early TH1 cytokine response. Highly glycosylated of IL18BP will migrate to be 40kd. A 58kd protein is IL18BP crosslinked IL18.