Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse IL-19 Rabbit Recombinant Antibody, PBS Only (98431-2-PBS)

Anti-Mouse IL-19 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Mouse IL-19 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98431-2-PBS-1MG

IL-19 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98431-2-PBS

Clone No. 242880F4

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Il19, Interleukin-19

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)

FC experiment of Transfected HEK-293T using 98431-2-RR (same clone as 98431-2-PBS)
1x10^6 HEK-293T cells (left) or IL-19 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse IL-19 Rabbit RecAb (98431-2-RR, Clone: 242880F4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98431-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells (left) or IL-19 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse IL-19 Rabbit RecAb (98431-2-RR, Clone: 242880F4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98431-2-PBS in a different storage buffer formulation.
FC experiment of Transfected HEK-293T using 98431-2-RR (same clone as 98431-2-PBS)
1x10^6 HEK-293T cells (left) or IL-19 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse IL-19 Rabbit RecAb (98431-2-RR, Clone: 242880F4) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98431-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells (left) or IL-19 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse IL-19 Rabbit RecAb (98431-2-RR, Clone: 242880F4) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98431-2-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for IL-19 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98431-2-PBS targets IL-19 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2844 Product name: Recombinant Mouse IL-19 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 25-176 aa of NM_001009940.1 Sequence: LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA Predict reactive species
Full Name	interleukin 19
Calculated Molecular Weight	20 kDa
GenBank Accession Number	NM_001009940.1
Gene Symbol	Il19
Gene ID (NCBI)	329244
RRID	AB_3746069
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q8CJ70
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

IL-19, a member of the IL-10 cytokine family, is expressed in epithelial cells, endothelial cells, and macrophages. It can bind the interleukin-20 receptor complex IL-20R1/IL-20R2 and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). IL-19 induces IL-6 and TNF-αproduction in monocytes. It also induces cell apoptosis and reactive oxygen species production in monocytes, which suggests a role of this cytokine in inflammatory responses. It is up-regulated in monocytes following stimulation with lipopolysaccharide (LPS), and granulocyte-macrophage colony-stimulating factor (GM-CSF). IL-19 alters the balance of Th1 and Th2 cells in favor of Th2 cells. IL-19 contributes to a range of diseases and disorders, such as breast cancer, squamous cell carcinoma of the skin, asthma, endotoxic shock, uremia, psoriasis, rheumatoid arthritis, and periodontal and vascular disease.