Anti-Mouse IL-19 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse IL-19 Rabbit Recombinant Antibody (98431-2-RR)

IL-19 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98431-2-RR Copied!

Clone No. 242880F4

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Il19, Interleukin-19

• 

  FC experiment of Transfected HEK-293T using 98431-2-RR

  1x10^6 HEK-293T cells (left) or IL-19 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse IL-19 Rabbit RecAb (98431-2-RR, Clone: 242880F4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98431-2-RR

  1x10^6 HEK-293T cells (left) or IL-19 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse IL-19 Rabbit RecAb (98431-2-RR, Clone: 242880F4) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-19 in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98431-2-RR targets IL-19 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2844

  Product name: Recombinant Mouse IL-19 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-176 aa of NM_001009940.1

  Sequence: LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

• Full Name: interleukin 19
• Calculated Molecular Weight: 20 kDa
• GenBank Accession Number: NM_001009940.1
• Gene Symbol: Il19
• Gene ID (NCBI): 329244
• RRID: AB_3746069
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8CJ70
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL-19, a member of the IL-10 cytokine family, is expressed in epithelial cells, endothelial cells, and macrophages. It can bind the interleukin-20 receptor complex IL-20R1/IL-20R2 and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). IL-19 induces IL-6 and TNF-α
production in monocytes. It also induces cell apoptosis and reactive oxygen species production in monocytes, which suggests a role of this cytokine in inflammatory responses. It is up-regulated in monocytes following stimulation with lipopolysaccharide (LPS), and granulocyte-macrophage colony-stimulating factor (GM-CSF). IL-19 alters the balance of Th1 and Th2 cells in favor of Th2 cells. IL-19 contributes to a range of diseases and disorders, such as breast cancer, squamous cell carcinoma of the skin, asthma, endotoxic shock, uremia, psoriasis, rheumatoid arthritis, and periodontal and vascular disease.