IL-24 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-24 Recombinant monoclonal antibody, PBS Only (87821-1-PBS)

IL-24 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87821-1-PBS

Clone No.251947B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

IL24, IL 24, interleukin 24, Interleukin-24, Melanoma differentiation-associated gene 7 protein

• 

  WB analysis of CHO using 87821-1-RR (same clone as 87821-1-PBS)

  CHO cells transfected with human IL-24 were subjected to SDS PAGE followed by western blot with 87821-1-RR (IL-24 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87821-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Jurkat using 87821-1-RR (same clone as 87821-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using IL-24 antibody (87821-1-RR, Clone: 251947B5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87821-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87821-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87821-1-RR against Human IL-24 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87821-1-PBS targets IL-24 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4971

  Product name: Recombinant Human IL-24 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 52-206 aa of BC009681

  Sequence: QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

• Full Name: interleukin 24
• Calculated Molecular Weight: 207 aa, 24 kDa
• GenBank Accession Number: BC009681
• Gene Symbol: IL-24
• Gene ID (NCBI): 11009
• RRID: AB_3745770
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13007
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin-24 (IL-24) , also known as Melanoma Differentiation-Associated gene 7 (mda-7) , is a protein that belongs to the IL-10 family of cytokines. It was initially discovered in 1995 by researchers Paul B. Fisher and colleagues as a gene that is induced during the terminal differentiation of melanoma cells. Unlike many other cytokines, IL-24 is secreted primarily by activated monocytes, macrophages, and T helper 2 (Th2) cells.