Anti-Mouse IL-28B Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse IL-28B Rabbit Recombinant Antibody (98567-3-RR)

IL-28B Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98567-3-RR Copied!

Clone No. 250563C9

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Ifnl3, IFN-lambda-3, Il28, Il28b, Interferon lambda-3

• 

  FC experiment of Transfected HEK-293T using 98567-3-RR

  1x10^6 HEK-293T cells (left) or IL-28B transfected HEK-293T cells (right) were stained with 0.25 ug Anti-Mouse IL-28B Rabbit RecAb (98567-3-RR, Clone: 250563C9) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using 98567-3-RR

  1x10^6 HEK-293T cells (left) or IL-28B transfected HEK-293T cells (right) were stained with 0.25 ug Anti-Mouse IL-28B Rabbit RecAb (98567-3-RR, Clone: 250563C9) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9)(blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 98567-3-RR

  Biolayer interferometry (BLl) kinetic assays of 98567-3-RR against Mouse IL-28B were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-28B in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98567-3-RR targets IL-28B in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3146

  Product name: Recombinant Mouse IL-28B/ IFNL3 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-193 aa of NM_177396.1

  Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV

• Full Name: interleukin 28B
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_177396.1
• Gene Symbol: Il28b
• Gene ID (NCBI): 338374
• RRID: AB_3746184
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8CGK6
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

IL-28B is a type III IFN, which shares many of the biological effects of type I IFNs but may have fewer side effects due to a more selective receptor distribution. It interacts with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA) (PMID: 20712453;12469119;16539846).