IL-33 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-33 Recombinant monoclonal antibody, PBS Only (83765-7-PBS)

IL-33 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 83765-7-PBS

Clone No.252156C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

IL33, C9orf26, IL 1F11, IL 33, IL-1F11

• 

  WB analysis using 83765-7-RR (same clone as 83765-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83765-7-RR (IL-33 antibody) at dilution of 1:2200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83765-7-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 83765-7-RR (same clone as 83765-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83765-7-RR (IL-33 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83765-7-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 83765-7-RR (same clone as 83765-7-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83765-7-RR (IL-33 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83765-7-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 83765-7-RR (same clone as 83765-7-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83765-7-RR (IL-33 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83765-7-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 83765-7-RR

  Biolayer interferometry (BLI) kinetic assays of 83765-7-RR against Human IL-33 were performed. The affinity constant is 0.468 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

83765-7-PBS targets IL-33 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7061

  Product name: Recombinant human IL33 protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 122-270 aa of BC047085

  Sequence: YLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

• Full Name: interleukin 33
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 31 kDa, 18 kDa
• GenBank Accession Number: BC047085
• Gene Symbol: IL-33
• Gene ID (NCBI): 90865
• RRID: AB_3743495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IL-33 is an IL-1 family cytokine and nuclear alarmin, is constitutively expressed in epithelial barrier tissues and human blood vessels. IL-33 is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. It also acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury. IL-33 is synthesized as a 30 kDa full-length precursor that can be processed into an ~18-20 kDa mature form by inflammatory proteases, with the mature form exhibiting substantially higher biological activity as an extracellular alarmin cytokine.