IL-33 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-33 Recombinant monoclonal antibody (83765-7-RR)

IL-33 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83765-7-RR

Clone No.252156C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

IL33, C9orf26, IL 1F11, IL 33, IL-1F11

• 

  WB analysis using 83765-7-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83765-7-RR (IL-33 antibody) at dilution of 1:2200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 83765-7-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83765-7-RR (IL-33 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 83765-7-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83765-7-RR (IL-33 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 83765-7-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83765-7-RR (IL-33 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 83765-7-RR

  Biolayer interferometry (BLI) kinetic assays of 83765-7-RR against Human IL-33 were performed. The affinity constant is 0.468 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HUVEC cells, hTERT-RPE1 cells, HeLa cells, human artery, mouse liver tissue, untreated RAW 264.7 cells, PMA and LPS-treated RAW 264.7 cells, mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4400
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83765-7-RR targets IL-33 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7061

  Product name: Recombinant human IL33 protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 122-270 aa of BC047085

  Sequence: YLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

• Full Name: interleukin 33
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 31 kDa, 18 kDa
• GenBank Accession Number: BC047085
• Gene Symbol: IL-33
• Gene ID (NCBI): 90865
• RRID: AB_3743495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95760
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-33 is an IL-1 family cytokine and nuclear alarmin, is constitutively expressed in epithelial barrier tissues and human blood vessels. IL-33 is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. It also acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury. IL-33 is synthesized as a 30 kDa full-length precursor that can be processed into an ~18-20 kDa mature form by inflammatory proteases, with the mature form exhibiting substantially higher biological activity as an extracellular alarmin cytokine.