FcZero-rAb® Biotin Anti-Mouse IL-3RB/CD131 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Mouse IL-3RB/CD131 Rabbit Recombinant Antibody (Biotin-FcA98232)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

IL-3RB/CD131 FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98232 Copied!

Clone No. 241954C1

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC, ELISA

Synonyms

Aic2b, CD131, Csf2rb, Csf2rb1, Cytokine receptor common subunit beta

• 

  FC experiment of mouse bone marrow cells using Biotin-FcA98232

  1x10^6 mouse bone marrow cells were surface stained with CoraLite® Plus 647 Anti-Mouse CD11b, and 0.25 ug Biotin Anti-Mouse IL-3RB/CD131 Rabbit RecAb (Biotin-FcA98232, Clone: 241954C1) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse bone marrow cells using Biotin-FcA98232

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Biotin Anti-Mouse IL-3RB/CD131 Rabbit RecAb (Biotin-FcA98232, Clone: 241954C1) (red) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IL-3RB/CD131 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98232 targets IL-3RB/CD131 in FC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2173

  Product name: Recombinant Mouse IL-3RB/CD131 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-441 aa of NM_007780.4

  Sequence: HGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGLINMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDSDLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKRLQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPPGASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSLHWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKPISNYDGIWSKWSEEYTWKTDW

• Full Name: colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage)
• Calculated Molecular Weight: 99kDa
• GenBank Accession Number: NM_007780.4
• Gene Symbol: IL-3RB/CD131
• Gene ID (NCBI): 12983
• RRID: AB_3746988
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26955
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD131, also known as IL-3RB, IL-5RB, colony stimulating factor 2 receptor subunit beta (CSF2RB), or cytokine receptor common subunit beta, is the common subunit of the type I cytokine receptors for granulocyte-macrophage colony-stimulating factor (GM-CSF), IL-3 and IL-5 (PMID: 36532080). It is expressed predominantly by hematopoietic cells but also by non-hematopoietic cells (PMID: 10582335). CD131 mediates intracellular signaling by JAK2, leading to phosphorylation of CD131 and triggering signaling pathways such as STAT5, MAPK and PI3-Kinase/AKT which regulate cell survival, proliferation and function (PMID: 23535386).