IL-4RA/CD124 Recombinant monoclonal antibody

• 

  IF Staining of Daudi using 84414-6-RR

  Immunofluorescent analysis of (4% PFA) fixed Daudi cells using IL-4R/CD124 antibody (84414-6-RR, Clone: 241824A11 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84414-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84414-6-RR against Human IL-4R/CD124 were performed. The affinity constant is below 1 pM.

IL-4RA/CD124 Uni-rAb^® Recombinant Antibody for IF/ICC, ELISA

Cat No. 84414-6-RR

Clone No.241824A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

IL4R, 241824A11, CD124, IL 4 binding protein, IL 4 receptor subunit alpha

---

Tested Applications

• Positive IF/ICC detected in: Daudi cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84414-6-RR targets IL-4RA/CD124 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1684

  Product name: Recombinant Human IL-4 R alpha/CD124 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-232 aa of NM_000418.4

  Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

• Full Name: interleukin 4 receptor
• Calculated Molecular Weight: 90 kDa
• GenBank Accession Number: NM_000418.4
• Gene Symbol: IL-4R
• Gene ID (NCBI): 3566
• RRID: AB_3671943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P24394-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Preparation of Suspension Cell Slides 1. Cell collection: Collect the suspension cell suspension, centrifuge at 1200 rpm for 5 min, then discard the supernatant. 2. Cell washing: Resuspend cells with PBS, centrifuge at 3000 rpm for 1 min, and remove the supernatant. Repeat the washing twice to completely remove residual culture medium. Fixation treatment: Resuspend cells with 4% paraformaldehyde, fix at room temperature for 10-15 min, centrifuge at 3000 rpm for 1 min, then discard the supernatant. 3. Fixative washing: Resuspend cells with PBS, centrifuge at 3000 rpm for 1 min, and discard the supernatant. Repeat the washing twice. 4. Coverslip seeding: Resuspend cells with an appropriate amount of PBS. Add 30 μL of cell suspension per well onto the pre-placed coverslips in a 24-well plate. 5. Drying: Place the plate in an oven at approximately 37 °C and dry for 1.5-2 h. The samples can then be used for subsequent tests such as immunofluorescence assay.