Use Able AI chat for product recommendations

IL-4RA/CD124 Recombinant monoclonal antibody, PBS Only

IL-4RA/CD124 Uni-rAb® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84414-6-PBS
Clone No.241824A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

IL4R, 241824A11, CD124, IL 4 binding protein, IL 4 receptor subunit alpha

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84414-6-PBS targets IL-4RA/CD124 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1684

Product name: Recombinant Human IL-4 R alpha/CD124 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 26-232 aa of NM_000418.4

Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Predict reactive species
Full Name interleukin 4 receptor
Calculated Molecular Weight90 kDa
GenBank Accession NumberNM_000418.4
Gene Symbol IL-4R
Gene ID (NCBI) 3566
RRIDAB_3671943
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP24394-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Preparation of Suspension Cell Slides 1. Cell collection: Collect the suspension cell suspension, centrifuge at 1200 rpm for 5 min, then discard the supernatant. 2. Cell washing: Resuspend cells with PBS, centrifuge at 3000 rpm for 1 min, and remove the supernatant. Repeat the washing twice to completely remove residual culture medium. Fixation treatment: Resuspend cells with 4% paraformaldehyde, fix at room temperature for 10-15 min, centrifuge at 3000 rpm for 1 min, then discard the supernatant. 3. Fixative washing: Resuspend cells with PBS, centrifuge at 3000 rpm for 1 min, and discard the supernatant. Repeat the washing twice. 4. Coverslip seeding: Resuspend cells with an appropriate amount of PBS. Add 30 μL of cell suspension per well onto the pre-placed coverslips in a 24-well plate. 5. Drying: Place the plate in an oven at approximately 37 °C and dry for 1.5-2 h. The samples can then be used for subsequent tests such as immunofluorescence assay.

Loading...
||
New chat

Able

正在加载,请稍候...