FcZero-rAb® PE Anti-Human IL-4RA/CD124 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® PE Anti-Human IL-4RA/CD124 Rabbit Recombinant Antibody (PE-FcA98203)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

IL-4RA/CD124 FcZero-rAb^® Recombinant Antibody for FC

Cat No. PE-FcA98203

Clone No.241824D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

IL4R, CD124, IL 4 binding protein, IL 4 receptor subunit alpha, IL 4R alpha

• 

  FC experiment of human PBMCs using PE-FcA98203

  1x10^6 human PBMCs were surface stained with FcZero-rAb™ APC Anti-Human CD19 (4G7), and 5 ul PE Anti-Human IL-4RA/CD124 Rabbit RecAb (PE-FcA98203, Clone: 241824D8) or PE Rabbit IgG Isotype Control RecAb (PE-FcA98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98203 targets IL-4RA/CD124 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1684

  Product name: Recombinant Human IL-4 R alpha/CD124 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-232 aa of NM_000418.4

  Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

• Full Name: interleukin 4 receptor
• Calculated Molecular Weight: 90 kDa
• GenBank Accession Number: NM_000418.4
• Gene Symbol: IL-4R
• Gene ID (NCBI): 3566
• RRID: AB_3749828
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24394-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

IL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and chemokine and mucus production at sites of allergic inflammation.