IL-6 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of HUVEC using 81077-1-RR (same clone as 81077-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 81077-1-RR (IL-6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81077-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-87 MG using 81077-1-RR (same clone as 81077-1-PBS)

  Protein transport inhibitor treated U-87 MG cells were subjected to SDS PAGE followed by western blot with 81077-1-RR (IL-6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81077-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP80002-1

  Cytometric bead array standard curve of MP80002-1, IL-6 Hybrid Matched Antibody Pair, PBS Only. Capture antibody: 81077-1-PBS. Detection antibody: 68659-10-PBS. Standard:HZ-1019 . Range: 1.563-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 81077-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 81077-1-PBS against Human IL-6 was performed. The affinity constant is below 1 pM.

• 

  Affinity and Kinetic Characterization of 81077-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81077-1-RR against Human IL-6 were performed. The affinity constant is below 1 pM.

IL-6 antibodies are used for both research and therapeutic purposes to detect, quantify, and block the activity of interleukin-6 (IL-6), a cytokine central to immune regulation, inflammation, hematopoiesis, and cancer biology. Proteintech has an extensive range of IL-6 antibodies validated for WB, IHC, IF/ICC, IP, Neutralization, ELISA and more.

Cat No. 81077-1-PBS

Clone No.2E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

IL6, 2E9, B-cell stimulatory factor 2, IFN-beta-2, IL 6

---

Product Information

81077-1-PBS targets IL-6 as part of a matched antibody pair:

MP80002-1: 81077-1-PBS capture and 68659-10-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10565

  Product name: Recombinant human IL-6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC015511

  Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

• Full Name: interleukin 6 (interferon, beta 2)
• Calculated Molecular Weight: 212 aa, 24 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC015511
• Gene Symbol: IL6
• Gene ID (NCBI): 3569
• ENSEMBL Gene ID: ENSG00000136244
• RRID: AB_2918927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05231
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.