FcZero-rAb® Biotin Anti-Human IL-6 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Human IL-6 Rabbit Recombinant Antibody (Biotin-FcA98087)

IL-6 FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. Biotin-FcA98087

Clone No.240670D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

IL6, B-cell stimulatory factor 2, IFN-beta-2, IL 6, Interferon beta-2

• 

  FC experiment of human PBMCs using Biotin-FcA98087

  1x10^6 untreated or LPS and Brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Biotin Anti-Human IL-6 Rabbit RecAb (Biotin-FcA98087, Clone: 240670D12) and Streptavidin-PE Conjugate (PE-PF00030). Cells were co-stained with FcZero-rAb® CoraLite® Plus 405 Anti-Human CD14 Rabbit Recombinant Antibody (CL405-FcA98040, Clone: 230332D7). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). Monocytes were gated.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using Biotin-FcA98087

  1x10^6 LPS and Brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Biotin Anti-Human IL-6 Rabbit RecAb (Biotin-FcA98087, Clone: 240670D12) (red) or FcZero-rAb® Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated human PBMCs were intracellularly stained with 0.25 ug Biotin Anti-Human IL-6 Rabbit RecAb (Biotin-FcA98087, Clone: 240670D12)(black, dashed) and Streptavidin-PE Conjugate (PE-PF00030). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). Monocytes were gated.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: LPS and Brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98087 targets IL-6 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0117

  Product name: Recombinant Human IL-6 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 30-212 aa of BC015511

  Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

• Full Name: interleukin 6 (interferon, beta 2)
• Calculated Molecular Weight: 212 aa, 24 kDa
• GenBank Accession Number: BC015511
• Gene Symbol: IL6
• Gene ID (NCBI): 3569
• ENSEMBL Gene ID: ENSG00000136244
• RRID: AB_3746906
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05231
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.