CD126/IL-6R alpha Monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP50060-1

  Sandwich ELISA standard curve of MP50060-1, CD126/IL-6R alpha Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68678-1-PBS. Detection antibody: 68678-2-PBS. Standard: Eg0180. Range: 31.25-2000 pg/mL.

• 

  Sample test of MP50060-1

  Serum of sixteen individual healthy human donors was measured. The CD126/IL-6R alpha concentration of detected samples was determined to be 53,676.1 pg/mL with a range of 25,815.4-89,497.4 pg/mL.

• 

  Sample test of MP50060-1

  Urine of eight individual healthy human donors was measured. The CD126/IL-6R alpha concentration of detected samples was determined to be 2,894.0 pg/mL with a range of 433.9-5,520.6 pg/mL.

• 

  Sample test of MP50060-1

  Human peripheral blood mononuclear cells (PBMC) were cultured unstimulated or stimulated with 10 μg/mL PHA for 5 days. The mean CD126/IL-6R alpha concentration was determined to be 277.9 pg/mL in unstimulated PBMC supernatant, 239.1 pg/mL in PHA stimulated PBMC supernatant.

CD126/IL-6R alpha Monoclonal Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 68678-1-PBS

Clone No.2B2A3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD126, IL-6R alpha, gp80, IL 6 receptor subunit alpha, IL 6R 1

---

Product Information

68678-1-PBS targets CD126/IL-6R alpha as part of a matched antibody pair:

MP50060-1: 68678-1-PBS capture and 68678-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0180

  Product name: Recombinant Human IL-6R alpha protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 20-365 aa of BC132684

  Sequence: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

• Full Name: interleukin 6 receptor
• Calculated Molecular Weight: 468 aa, 52 kDa
• GenBank Accession Number: BC132684
• Gene Symbol: IL-6R alpha
• Gene ID (NCBI): 3570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08887
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.