• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® Biotin Anti-Human IL-7Ra/CD127 Rabbit Recombinant Antibody

IL-7Ra/CD127 FcZero-rAb® Recombinant Antibody for FC
Cat No. Biotin-FcA98074
Clone No.240749H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD127, IL 7 receptor subunit alpha, IL 7R alpha, IL 7R subunit alpha, IL 7RA

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98074 targets IL-7Ra/CD127 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1279

Product name: Recombinant Human IL-7RA/CD127 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-239 aa of AAC83204.1

Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD

Predict reactive species
Full Name interleukin 7 receptor
Calculated Molecular Weight52 kDa
GenBank Accession NumberAAC83204.1
Gene Symbol CD127
Gene ID (NCBI) 3575
ENSEMBL Gene IDENSG00000168685
Conjugate Biotin
Excitation/Emission Maxima Wavelengths-
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16871-1(I66T, V138I)
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD127, also known as IL-7R subunit alpha (IL-7RA), is a type I membrane glycoprotein expressed on thymocytes, B cell precursors, most T cells, and some lymphoid and myeloid cells. IL-7R is a heterodimer composed of CD127 and the common-γ chain receptor (CD132). IL-7R plays critical roles in lymphocyte development and homeostasis. CD127 can also act as a receptor for thymic stromal lymphopoietin (TSLP).

Protocols

Product Specific Protocols
FC protocol for Biotin IL-7Ra/CD127 antibody Biotin-FcA98074Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...