IL-12A Monoclonal antibody

IL-12A Monoclonal Antibody for WB, IHC, ELISA
Cat No. 60324-1-Ig
Clone No.6A10A8

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, ELISA

CLMF, CLMF p35, IL 12 subunit p35, IL 12A, IL12A, IL-12A, Interleukin 12 subunit alpha, NFSK, NKSF1, P35

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRecombinant protein
Positive IHC detected inhuman kidney tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60324-1-Ig targets IL-12A in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17625

Product name: Recombinant human IL-12A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-200 aa of BC104982

Sequence: MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDEL

Predict reactive species
Full Name interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
Calculated Molecular Weight 25 kDa
GenBank Accession NumberBC104982
Gene Symbol IL-12A
Gene ID (NCBI) 3592
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29459
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL12A is a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of IFN-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Protocols

Product Specific Protocols
WB protocol for IL-12A antibody 60324-1-IgDownload protocol
IHC protocol for IL-12A antibody 60324-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...