IL-12RB1/CD212 Monoclonal antibody

• 

  WB analysis of Ramos using 66829-1-Ig

  Ramos cells were subjected to SDS PAGE followed by western blot with 66829-1-Ig (IL12RB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66829-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66829-1-Ig (IL12RB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66829-1-Ig

  WB result of IL-12RB1 antibody (66829-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-IL-12RB1 transfected Jurkat cells.

• 

  WB analysis of Raji using 66829-1-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 66829-1-Ig (IL12RB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 66829-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 66829-1-Ig (IL12RB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66829-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66829-1-Ig (IL12RB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 66829-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using IL-12RB1 antibody (66829-1-Ig, Clone: 1E10E10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

• Featured Product
• KD/KO Validated

IL-12RB1/CD212 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66829-1-Ig

Clone No.1E10E10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

IL12RB1, 1E10E10, CD212, IL 12R beta 1, IL 12R subunit beta 1

---

Tested Applications

• Positive WB detected in: Ramos cells, TF-1 cells, THP-1 cells, Jurkat cells, Raji cells, K-562 cells, Daudi cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66829-1-Ig targets IL-12RB1/CD212 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6920

  Product name: Recombinant human IL-12RB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-381 aa of BC029121

  Sequence: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

• Full Name: interleukin 12 receptor, beta 1
• Calculated Molecular Weight: 662 aa, 73 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC029121
• Gene Symbol: IL12RB1
• Gene ID (NCBI): 3594
• RRID: AB_2882172
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P42701
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL12RB1, also named as Interleukin-12 receptor subunit beta-1 or CD212, is a 662 amino acid protein, which contains 5 fibronectin type-III domains and belongs to the type I cytokine receptor family. Type 2 subfamily. IL12RB1 localizes in the membrane and functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.