IL-20RB Polyclonal antibody

• 

  WB analysis using 20521-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20521-1-AP (IL-20RB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

IL-20RB Polyclonal Antibody for WB, ELISA

Cat No. 20521-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

Synonyms

IL20RB, IL 20R2, IL 20R beta, IL 20 receptor subunit beta, FNDC6

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below
• FC: See 1 publications below

Product Information

20521-1-AP targets IL-20RB in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14368

  Product name: Recombinant human IL-20RB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-147 aa of BC033292

  Sequence: MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC

• Full Name: interleukin 20 receptor beta
• Calculated Molecular Weight: 311 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC033292
• Gene Symbol: IL-20RB
• Gene ID (NCBI): 53833
• RRID: AB_10700002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXL0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-20 receptor subunit beta (IL20RB) is a single-pass type I membrane protein of the type II cytokine receptor family. The interleukin-20-receptor I complex (IL-20-RI) is composed of two chains, IL20RA and IL20RB. IL-20-RI is a receptor for IL-19, IL-20 and IL-24. IL20RB can also form a heterodimer with IL22RA1. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	FC	Front Immunol; Integrative single-cell transcriptomic investigation unveils long non-coding RNAs associated with localized cellular inflammation in psoriasis; Authors - Yuge Gao
human,mouse	WB,IF	J Transl Med; IL20RB signaling enhances stemness and chemotherapy resistance in pancreatic cancer; Authors - Xiao-Hui Li