IL-20RB Polyclonal antibody

IL-20RB Polyclonal Antibody for WB, ELISA
Cat No. 20521-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

IL20RB, IL 20R2, IL 20R beta, IL 20 receptor subunit beta, FNDC6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20521-1-AP targets IL-20RB in WB, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14368

Product name: Recombinant human IL-20RB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-147 aa of BC033292

Sequence: MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC

Predict reactive species
Full Name interleukin 20 receptor beta
Calculated Molecular Weight 311 aa, 35 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC033292
Gene Symbol IL-20RB
Gene ID (NCBI) 53833
RRIDAB_10700002
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6UXL0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-20 receptor subunit beta (IL20RB) is a single-pass type I membrane protein of the type II cytokine receptor family. The interleukin-20-receptor I complex (IL-20-RI) is composed of two chains, IL20RA and IL20RB. IL-20-RI is a receptor for IL-19, IL-20 and IL-24. IL20RB can also form a heterodimer with IL22RA1. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.

Protocols

Product Specific Protocols
WB protocol for IL-20RB antibody 20521-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanFC

Front Immunol

Integrative single-cell transcriptomic investigation unveils long non-coding RNAs associated with localized cellular inflammation in psoriasis

Authors - Yuge Gao
human,mouseWB,IF

J Transl Med

IL20RB signaling enhances stemness and chemotherapy resistance in pancreatic cancer

Authors - Xiao-Hui Li
Loading...
||
New chat Able
正在加载,请稍候...