IL-29 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IL-29 Recombinant monoclonal antibody (86548-3-RR)

• 

  WB analysis of CHO using 86548-3-RR

  Transfected with Human IL29 CHO cells were subjected to SDS PAGE followed by western blot with 86548-3-RR (IL29 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Transfected CHO-K1 using 86548-3-RR

  Immunofluorescent analysis of (4% PFA) fixed Transfected CHO-K1 using IL-29 antibody (86548-3-RR, Clone: 250226F7 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  Affinity and Kinetic Characterization of 86548-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86548-3-RR against Human IL-29 were performed. The affinity constant is 26.2 nM.

IL-29 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86548-3-RR

Clone No.250226F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

IL29, Cytokine Zcyto21, IFN lambda 1, IFNL1, IFN-lambda-1

---

Tested Applications

• Positive WB detected in: Transfected with Human IL29 CHO cells
• Positive IF/ICC detected in: Transfected CHO-K1

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86548-3-RR targets IL-29 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2843

  Product name: Recombinant Human IL-29 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-200 aa of NM_172140.1

  Sequence: GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

• Full Name: interleukin 29 (interferon, lambda 1)
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_172140.1
• Gene Symbol: IL-29
• Gene ID (NCBI): 282618
• RRID: AB_3744959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IU54
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.