ILK Recombinant monoclonal antibody, PBS Only

ILK Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 85428-5-PBS
Clone No.242982A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

59 kDa serine/threonine-protein kinase, Beta-integrin-linked kinase, EC:2.7.11.1, ILK 1, ILK 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85428-5-PBS targets ILK in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3570

Product name: Recombinant human ILK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 102-451 aa of BC001554

Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD

Predict reactive species
Full Name integrin-linked kinase
Calculated Molecular Weight 451 aa, 59 kDa
Observed Molecular Weight51 kDa
GenBank Accession NumberBC001554
Gene Symbol ILK
Gene ID (NCBI) 3611
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13418
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ILK(Integrin-linked protein kinase) is also named as p59, PAT-4, DKFZp686F1765, ILK-1, ILK-2, ILK1, ILK2, p59ILK and belongs to the TKL Ser/Thr protein kinase family. This protein localizes to multiple sites, including the cytoplasm, and imports into the nucleus through sequences in its N-terminus, via active transport mechanisms that involve nuclear pore complexes(PMID: 18635968). ILK performs crucial roles in the control of intestinal cell and crypt-villus axis homeostasis-especially with regard to basement membrane fibronectin deposition-as well as cell proliferation, spreading, and migration(PMID:19885839).

Loading...
||
New chat Able
正在加载,请稍候...