ILVBL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ILVBL Polyclonal antibody, PBS Only (11220-1-PBS)

• 

  WB analysis using 11220-1-AP (same clone as 11220-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11220-1-AP (ILVBL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11220-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11220-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11220-1-AP (ILVBL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human thyroid gland using 11220-1-AP (same clone as 11220-1-PBS)

  human thyroid gland tissue were subjected to SDS PAGE followed by western blot with 11220-1-AP (ILVBL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11220-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 11220-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11220-1-AP (ILVBL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 11220-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11220-1-AP (ILVBL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 11220-1-AP (same clone as 11220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11220-1-AP (ILVBL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11220-1-AP (same clone as 11220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11220-1-AP (ILVBL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11220-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11220-1-AP (same clone as 11220-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11220-1-AP (ILVBL antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11220-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11220-1-AP (same clone as 11220-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ILVBL antibody (11220-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11220-1-PBS in a different storage buffer formulation.

ILVBL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11220-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HACL2, EC:4.1.2.-, AHAS, Acetolactate synthase-like protein, 2-hydroxyacyl-CoA lyase 2

---

Product Information

11220-1-PBS targets ILVBL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1729

  Product name: Recombinant human ILVBL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 284-632 aa of BC011761

  Sequence: KRPLMVLGSQALLTPTSADKLRAAVETLGVPCFLGGMARGLLGRNHPLHIRENRSAALKKADVIVLAGTVCDFRLSYGRVLSHSSKIIIVDRNREEMLLNSDIFWKPQEAVQGDVGSFVLKLVEGLQGQTWAPDWVEELREADRQKEQTFREKAAMPVAQHLNPVQVLQLVEETLPDNSILVVDGGDFVGTAAHLVQPRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVKVLHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV

• Full Name: ilvB (bacterial acetolactate synthase)-like
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC011761
• Gene Symbol: ILVBL
• Gene ID (NCBI): 10994
• RRID: AB_2127187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1L0T0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.