IMMP1L Polyclonal antibody

• 

  WB analysis using 16434-1-AP

  mouse liver total extract lysate and mitochondria extract lysate were subjected to SDS PAGE followed by western blot with 16434-1-AP (IMMP1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IMMP1L Polyclonal Antibody for WB, ELISA

Cat No. 16434-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

IMMP1L, IMP1, IMP1 LIKE, IMP1 like protein

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16434-1-AP targets IMMP1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9747

  Product name: Recombinant human IMMP1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC023595

  Sequence: MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD

• Full Name: IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae)
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC023595
• Gene Symbol: IMMP1L
• Gene ID (NCBI): 196294
• RRID: AB_2923562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IMMP1L, a member of the peptidase S26 family, catalyzes the removal of transport peptides that target proteins from the mitochondrial matrix, across the inner membrane, and into the intermembrane space.IMMP1L is localized on the Mitochondrion inner membrane. Heterodimer of 2 subunits, IMMPL1 and IMMPL2 (PMID: 26341627; 28337252).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse		Cell Rep; An updated inventory of genes essential for oxidative phosphorylation identifies a mitochondrial origin in familial Ménière's disease; Authors - Marcell Harhai