IMMP2L Polyclonal antibody

IMMP2L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15970-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

EC:3.4.21.-, IMP2, IMP2 LIKE, IMP2 like protein, IMP2-like protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWBIHC

WB analysis of human kidney using 15970-1-AP
human kidney tissue were subjected to SDS PAGE followed by western blot with 15970-1-AP (IMMP2L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human heart using 15970-1-AP
human heart tissue were subjected to SDS PAGE followed by western blot with 15970-1-AP (IMMP2L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 15970-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer using 15970-1-AP (IMMP2L antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 15970-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer using 15970-1-AP (IMMP2L antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in	human kidney tissue, human heart tissue
Positive IHC detected in	human lung cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Application	Dilution
Western Blot (WB)	WB : 1:300-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

15970-1-AP targets IMMP2L in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8752 Product name: Recombinant human IMMP2L protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-110 aa of BC008497 Sequence: MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRDGRKLKRI Predict reactive species
Full Name	IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae)
Calculated Molecular Weight	12 kDa, 20 kDa
Observed Molecular Weight	12 kDa
GenBank Accession Number	BC008497
Gene Symbol	IMMP2L
Gene ID (NCBI)	83943
RRID	AB_2233868
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96T52
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IHC protocol for IMMP2L antibody 15970-1-AP	Download protocol
WB protocol for IMMP2L antibody 15970-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
mouse	WB	Endocrinology The Immp2l Mutation Causes Ovarian Aging Through ROS-Wnt/β-Catenin-Estrogen Pathway: Preventive Effect of Melatonin. Authors - Qing He View Article
		Neurochem Res Grape Seed Proanthocyanidin Extract (GSPE) Mitigates Preterm White Matter Injury in Mice Via Improving Mitochondrial Homeostasis and Activity of IMMP2L-Related Signaling Pathway. Authors - Nina Wang View Article