IMMT Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IMMT Recombinant monoclonal antibody, PBS Only (88213-2-PBS)

IMMT Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 88213-2-PBS

Clone No.260293A12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Cell proliferation-inducing gene 4/52 protein, HMP, MIC60, MICOS complex subunit MIC60, MINOS2

• 

  WB analysis using 88213-2-RR (same clone as 88213-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88213-2-RR (IMMT antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88213-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 88213-2-RR (same clone as 88213-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IMMT antibody (88213-2-RR, Clone: 260293A12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 88213-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88213-2-PBS targets IMMT in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0102

  Product name: Recombinant human IMMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-297 aa of BC002412

  Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK

• Full Name: inner membrane protein, mitochondrial (mitofilin)
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC002412
• Gene Symbol: IMMT
• Gene ID (NCBI): 10989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16891
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function.