IMMT Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• IMMT Recombinant monoclonal antibody (88213-2-RR)

IMMT Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 88213-2-RR

Clone No.260293A12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Cell proliferation-inducing gene 4/52 protein, HMP, MIC60, MICOS complex subunit MIC60, MINOS2

• 

  WB analysis using 88213-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88213-2-RR (IMMT antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 88213-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IMMT antibody (88213-2-RR, Clone: 260293A12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, Raji cells, A-673 cells, mouse brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88213-2-RR targets IMMT in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0102

  Product name: Recombinant human IMMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-297 aa of BC002412

  Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK

• Full Name: inner membrane protein, mitochondrial (mitofilin)
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC002412
• Gene Symbol: IMMT
• Gene ID (NCBI): 10989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16891
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function.