IMP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• IMP3 Polyclonal antibody, PBS Only (12750-1-PBS)

• 

  WB analysis of HeLa using 12750-1-AP (same clone as 12750-1-PBS)

  WB result of IMP3 antibody (12750-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IMP3 transfected HeLa cells. This data was developed using the same antibody clone with 12750-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12750-1-AP (same clone as 12750-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12750-1-AP (IMP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12750-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12750-1-AP (same clone as 12750-1-PBS)

  IP result of anti-IMP3 (IP:12750-1-AP, 3ug; Detection:12750-1-AP 1:500) with HeLa cells lysate 1200ug. This data was developed using the same antibody clone with 12750-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 12750-1-AP (same clone as 12750-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12750-1-AP (IMP3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12750-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 12750-1-AP (same clone as 12750-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IMP3 antibody (12750-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12750-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IMP3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12750-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

MRPS4, IMP 3, C15orf12, BRMS2

---

Product Information

12750-1-PBS targets IMP3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3477

  Product name: Recombinant human IMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC020557

  Sequence: MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA

• Full Name: IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)
• Calculated Molecular Weight: 184 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC020557
• Gene Symbol: IMP3
• Gene ID (NCBI): 55272
• RRID: AB_2122784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NV31
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IMP U3 small nucleolar ribonucleoprotein 3 (IMP3, BRMS2), is a component of U3 small nucleolar ribonucleoprotein complex (U3 snoRNP), has been identified as a participant in pre-rRNA processing for nearly twenty years.