CoraLite®555-conjugated IMP3 Monoclonal antibody

IMP3 Monoclonal Antibody for FC (Intra)
Cat No. CL555-66247
Clone No.1E7D6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

FC (Intra)

MRPS4, IMP 3, C15orf12, BRMS2, 1E7D6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-66247 targets IMP3 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23602

Product name: Recombinant human IMP3 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-184 aa of BC020557

Sequence: MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA

Predict reactive species
Full Name IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)
Calculated Molecular Weight 184 aa, 22 kDa
GenBank Accession NumberBC020557
Gene Symbol IMP3
Gene ID (NCBI) 55272
RRIDAB_2919680
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
Excitation LaserGreen Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NV31
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IMP3 is a member of the insulin-like growth factor (IGF-II) mRNA binding protein (IMP) family that consist of IMP1, IMP2, and IMP3. IMP3 is an oncofetal protein associated with aggressive and advanced tumors and is specifically expressed in malignant tumors but not found in benign tissues [PMID:22497850]. IMP3 forms a ternary complex with IMP4 and MPP10 (MPHOSPH10) that interacts with U3 small nucleolar RNA (snoRNA), which is required for the early cleavage steps in pre-rRNA processing[PMID: 12655004].

Protocols

Product Specific Protocols
FC protocol for CL555 IMP3 antibody CL555-66247Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...